Lineage for d1p51d_ (1p51 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715143Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
    automatically mapped to Pfam PF00216
  6. 2715144Protein HU protein [47735] (5 species)
  7. 2715145Species Anabaena sp. [TaxId:1167] [89074] (3 PDB entries)
  8. 2715153Domain d1p51d_: 1p51 D: [87791]
    protein/DNA complex

Details for d1p51d_

PDB Entry: 1p51 (more details), 2.5 Å

PDB Description: Anabaena HU-DNA cocrystal structure (AHU6)
PDB Compounds: (D:) DNA-binding protein HU

SCOPe Domain Sequences for d1p51d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p51d_ a.55.1.1 (D:) HU protein {Anabaena sp. [TaxId: 1167]}
mnkgelvdavaekasvtkkqadavltaaletiieavssgdkvtlvgfgsfesrerkareg
rnpktnekmeipatrvpafsagklfrekvapp

SCOPe Domain Coordinates for d1p51d_:

Click to download the PDB-style file with coordinates for d1p51d_.
(The format of our PDB-style files is described here.)

Timeline for d1p51d_: