Lineage for d1p50a1 (1p50 A:2-95)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772927Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 772928Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family) (S)
  5. 772929Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 772930Protein Arginine kinase, N-domain [48042] (1 species)
  7. 772931Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (7 PDB entries)
    Uniprot P51541
  8. 772939Domain d1p50a1: 1p50 A:2-95 [87786]
    Other proteins in same PDB: d1p50a2
    complexed with adp, arg, mg, no3; mutant

Details for d1p50a1

PDB Entry: 1p50 (more details), 2.8 Å

PDB Description: transition state structure of an arginine kinase mutant
PDB Compounds: (A:) arginine kinase

SCOP Domain Sequences for d1p50a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p50a1 a.83.1.1 (A:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
dsgvgiyapdaesyrtfgplfdpiiddyhggfkl

SCOP Domain Coordinates for d1p50a1:

Click to download the PDB-style file with coordinates for d1p50a1.
(The format of our PDB-style files is described here.)

Timeline for d1p50a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p50a2