SCOP 1.73: Domain d1p50a1: 1p50 A:2-95

Lineage for d1p50a1 (1p50 A:2-95)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family)

5. Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)

6. Protein Arginine kinase, N-domain [48042] (1 species)

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (7 PDB entries)

8. Domain d1p50a1: 1p50 A:2-95 [87786]
   Other proteins in same PDB: d1p50a2
   complexed with adp, arg, mg, no3; mutant

Details for d1p50a1

PDB Entry: 1p50, 2.8 Å

PDB Description: transition state structure of an arginine kinase mutant

PDB Compounds: (A:) arginine kinase

SCOP Domain Sequences for d1p50a1:

Sequence; same for both SEQRES and ATOM records:

>d1p50a1 a.83.1.1 (A:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
dsgvgiyapdaesyrtfgplfdpiiddyhggfkl

Timeline for d1p50a1:

• d1p50a1 first appeared in SCOP 1.65
  
• d1p50a1 appears in SCOP 1.71
  
• d1p50a1 appears in SCOP 1.75
  
• d1p50a1 appears in the current release, SCOPe 2.08