Lineage for d1p50a1 (1p50 A:2-95)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283447Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 283448Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family) (S)
  5. 283449Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 283450Protein Arginine kinase, N-domain [48042] (1 species)
  7. 283451Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (5 PDB entries)
  8. 283457Domain d1p50a1: 1p50 A:2-95 [87786]
    Other proteins in same PDB: d1p50a2
    complexed with adp, arg, mg, no3; mutant

Details for d1p50a1

PDB Entry: 1p50 (more details), 2.8 Å

PDB Description: transition state structure of an arginine kinase mutant

SCOP Domain Sequences for d1p50a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p50a1 a.83.1.1 (A:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus)}
vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
dsgvgiyapdaesyrtfgplfdpiiddyhggfkl

SCOP Domain Coordinates for d1p50a1:

Click to download the PDB-style file with coordinates for d1p50a1.
(The format of our PDB-style files is described here.)

Timeline for d1p50a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p50a2