SCOPe 2.03: Domain d1p4xa2: 1p4x A:126-250

Lineage for d1p4xa2 (1p4x A:126-250)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Staphylococcal accessory regulator A homolog, SarS [88977] (1 species)
   duplication: tandem repeat of two SarR-like domains assembled together as in the SarR dimer

7. Species Staphylococcus aureus [TaxId:1280] [88978] (1 PDB entry)

8. Domain d1p4xa2: 1p4x A:126-250 [87785]

Details for d1p4xa2

PDB Entry: 1p4x, 2.2 Å

PDB Description: crystal structure of sars protein from staphylococcus aureus

PDB Compounds: (A:) staphylococcal accessory regulator A homologue

SCOPe Domain Sequences for d1p4xa2:

Sequence; same for both SEQRES and ATOM records:

>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]}
sqmipkdskeflnlmmytmyfkniikkhltlsfveftilaiitsqnknivllkdlietih
hkypqtvralnnlkkqgylikerstederkilihmddaqqdhaeqllaqvnqlladkdhl
hlvfe

Timeline for d1p4xa2:

• d1p4xa2 first appeared in SCOP 1.65
  
• d1p4xa2 appears in SCOPe 2.02
  
• d1p4xa2 appears in SCOPe 2.04
  
• d1p4xa2 appears in the current release, SCOPe 2.08