SCOPe 2.08: Domain d1p4xa1: 1p4x A:1-125

Lineage for d1p4xa1 (1p4x A:1-125)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Staphylococcal accessory regulator A homolog, SarS [88977] (1 species)
   duplication: tandem repeat of two SarR-like domains assembled together as in the SarR dimer

7. Species Staphylococcus aureus [TaxId:1280] [88978] (1 PDB entry)

8. Domain d1p4xa1: 1p4x A:1-125 [87784]
   missing some secondary structures that made up less than one-third of the common domain

Details for d1p4xa1

PDB Entry: 1p4x, 2.2 Å

PDB Description: crystal structure of sars protein from staphylococcus aureus

PDB Compounds: (A:) staphylococcal accessory regulator A homologue

SCOPe Domain Sequences for d1p4xa1:

Sequence; same for both SEQRES and ATOM records:

>d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]}
mkynnhdkirdfiiieaymfrfkkkvkpevdmtikefilltylfhqqentlpfkkivsdl
cykqsdlvqhikvlvkhsyiskvrskiderntyisiseeqrekiaervtlfdqiikqfnl
adqse

Timeline for d1p4xa1:

• d1p4xa1 first appeared in SCOP 1.65
  
• d1p4xa1 appears in SCOPe 2.07