SCOPe 2.04: Domain d1p4wa_: 1p4w A:

Lineage for d1p4wa_ (1p4w A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
   contains additional, fourth helix in the C-terminal extension

6. Protein Transcriptional regulator RcsB [88990] (1 species)

7. Species Erwinia amylovora [TaxId:552] [88991] (1 PDB entry)

8. Domain d1p4wa_: 1p4w A: [87783]
   DNA-binding domain only

Details for d1p4wa_

PDB Entry: 1p4w

PDB Description: solution structure of the dna-binding domain of the erwinia amylovora rcsb protein

PDB Compounds: (A:) rcsB

SCOPe Domain Sequences for d1p4wa_:

Sequence; same for both SEQRES and ATOM records:

>d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]}
ytpesvakllekisaggygdkrlspkesevlrlfaegflvteiakklnrsiktissqkks
ammklgvdndiallnylssvsmtpvdk

Timeline for d1p4wa_:

• d1p4wa_ first appeared in SCOP 1.65
  
• d1p4wa_ appears in SCOPe 2.03
  
• d1p4wa_ appears in SCOPe 2.05
  
• d1p4wa_ appears in the current release, SCOPe 2.08