Class a: All alpha proteins [46456] (179 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (4 proteins) contains additional, fourth helix in the C-terminal extension |
Protein Transcriptional regulator RcsB [88990] (1 species) |
Species Erwinia amylovora [TaxId:552] [88991] (1 PDB entry) |
Domain d1p4wa_: 1p4w A: [87783] DNA-binding domain only |
PDB Entry: 1p4w (more details)
SCOP Domain Sequences for d1p4wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora} ytpesvakllekisaggygdkrlspkesevlrlfaegflvteiakklnrsiktissqkks ammklgvdndiallnylssvsmtpvdk
Timeline for d1p4wa_: