Lineage for d1p4wa_ (1p4w A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 278295Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 278314Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (4 proteins)
    contains additional, fourth helix in the C-terminal extension
  6. 278342Protein Transcriptional regulator RcsB [88990] (1 species)
  7. 278343Species Erwinia amylovora [TaxId:552] [88991] (1 PDB entry)
  8. 278344Domain d1p4wa_: 1p4w A: [87783]
    DNA-binding domain only

Details for d1p4wa_

PDB Entry: 1p4w (more details)

PDB Description: solution structure of the dna-binding domain of the erwinia amylovora rcsb protein

SCOP Domain Sequences for d1p4wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora}
ytpesvakllekisaggygdkrlspkesevlrlfaegflvteiakklnrsiktissqkks
ammklgvdndiallnylssvsmtpvdk

SCOP Domain Coordinates for d1p4wa_:

Click to download the PDB-style file with coordinates for d1p4wa_.
(The format of our PDB-style files is described here.)

Timeline for d1p4wa_: