Lineage for d1p4vc_ (1p4v C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512789Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 512790Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 513243Family d.153.1.5: (Glycosyl)asparaginase [56261] (1 protein)
  6. 513244Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (3 species)
    the precursor chain is cleaved onto 2 fragments by autoproteolysis
  7. 513252Species Flavobacterium meningosepticum [TaxId:238] [56264] (8 PDB entries)
  8. 513264Domain d1p4vc_: 1p4v C: [87782]
    precursor D151N mutant

Details for d1p4vc_

PDB Entry: 1p4v (more details), 1.9 Å

PDB Description: crystal structure of the glycosylasparaginase precursor d151n mutant with glycine

SCOP Domain Sequences for d1p4vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4vc_ d.153.1.5 (C:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Flavobacterium meningosepticum}
ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
enlltaesekewkewlktsqykpivnienhntigmialdaqgnlsgacttsgmaykmhgr
vgdspiigaglfvdneigaatatghgeevirtvgthlvvelmnqgrtpqqackeaveriv
kivnrrgknlkdiqvgfialnkkgeygayciqdgfnfavhdqkgnrletpgfalk

SCOP Domain Coordinates for d1p4vc_:

Click to download the PDB-style file with coordinates for d1p4vc_.
(The format of our PDB-style files is described here.)

Timeline for d1p4vc_: