Lineage for d1p4qb_ (1p4q B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067412Fold g.53: TAZ domain [57932] (1 superfamily)
    all-alpha fold; Zn-binding sites are in the loops connecting helices
  4. 1067413Superfamily g.53.1: TAZ domain [57933] (1 family) (S)
  5. 1067414Family g.53.1.1: TAZ domain [57934] (1 protein)
  6. 1067415Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species)
  7. 1067416Species Human (Homo sapiens) [TaxId:9606] [75696] (3 PDB entries)
  8. 1067419Domain d1p4qb_: 1p4q B: [87778]
    Other proteins in same PDB: d1p4qa_
    CH1 (TAZ1) domain; complexed with Cited2 transactivation domain (chain A)
    complexed with zn

Details for d1p4qb_

PDB Entry: 1p4q (more details)

PDB Description: solution structure of the cited2 transactivation domain in complex with the p300 ch1 domain
PDB Compounds: (B:) E1A-associated protein p300

SCOPe Domain Sequences for d1p4qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4qb_ g.53.1.1 (B:) CREB-binding transcriptional adaptor protein CBP (p300) {Human (Homo sapiens) [TaxId: 9606]}
mgsgahtadpekrkliqqqlvlllhahkcqrreqangevrqcnlphcrtmknvlnhmthc
qsgkscqvahcassrqiishwknctrhdcpvclplknagdk

SCOPe Domain Coordinates for d1p4qb_:

Click to download the PDB-style file with coordinates for d1p4qb_.
(The format of our PDB-style files is described here.)

Timeline for d1p4qb_: