![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.53: TAZ domain [57932] (1 superfamily) all-alpha fold; Zn-binding sites are in the loops connecting helices |
![]() | Superfamily g.53.1: TAZ domain [57933] (1 family) ![]() |
![]() | Family g.53.1.1: TAZ domain [57934] (1 protein) |
![]() | Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75696] (3 PDB entries) |
![]() | Domain d1p4qb_: 1p4q B: [87778] Other proteins in same PDB: d1p4qa_ CH1 (TAZ1) domain; complexed with Cited2 transactivation domain (chain A) complexed with zn |
PDB Entry: 1p4q (more details)
SCOP Domain Sequences for d1p4qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p4qb_ g.53.1.1 (B:) CREB-binding transcriptional adaptor protein CBP (p300) {Human (Homo sapiens) [TaxId: 9606]} mgsgahtadpekrkliqqqlvlllhahkcqrreqangevrqcnlphcrtmknvlnhmthc qsgkscqvahcassrqiishwknctrhdcpvclplknagdk
Timeline for d1p4qb_: