SCOP 1.75: Domain d1p4qb_: 1p4q B:

Lineage for d1p4qb_ (1p4q B:)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.53: TAZ domain [57932] (1 superfamily)
   all-alpha fold; Zn-binding sites are in the loops connecting helices

4. Superfamily g.53.1: TAZ domain [57933] (1 family)

5. Family g.53.1.1: TAZ domain [57934] (1 protein)

6. Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75696] (3 PDB entries)

8. Domain d1p4qb_: 1p4q B: [87778]
   Other proteins in same PDB: d1p4qa_
   CH1 (TAZ1) domain; complexed with Cited2 transactivation domain (chain A)
   complexed with zn

Details for d1p4qb_

PDB Entry: 1p4q

PDB Description: solution structure of the cited2 transactivation domain in complex with the p300 ch1 domain

PDB Compounds: (B:) E1A-associated protein p300

SCOP Domain Sequences for d1p4qb_:

Sequence; same for both SEQRES and ATOM records:

>d1p4qb_ g.53.1.1 (B:) CREB-binding transcriptional adaptor protein CBP (p300) {Human (Homo sapiens) [TaxId: 9606]}
mgsgahtadpekrkliqqqlvlllhahkcqrreqangevrqcnlphcrtmknvlnhmthc
qsgkscqvahcassrqiishwknctrhdcpvclplknagdk

Timeline for d1p4qb_:

• d1p4qb_ first appeared in SCOP 1.65
  
• d1p4qb_ appears in SCOP 1.73
  
• d1p4qb_ appears in SCOPe 2.01
  
• d1p4qb_ appears in the current release, SCOPe 2.08