![]() | Class j: Peptides [58231] (120 folds) |
![]() | Fold j.96: Transactivation domain [81275] (1 superfamily) |
![]() | Superfamily j.96.1: Transactivation domain [74800] (1 family) ![]() |
![]() | Family j.96.1.1: Transactivation domain [74801] (2 proteins) |
![]() | Protein Cbp/p300-interacting transactivator 2, Cited2 [90295] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [90296] (2 PDB entries) |
![]() | Domain d1p4qa_: 1p4q A: [87777] Other proteins in same PDB: d1p4qb_ complexed with TAZ1 domain of mouse CBP complexed with zn |
PDB Entry: 1p4q (more details)
SCOPe Domain Sequences for d1p4qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p4qa_ j.96.1.1 (A:) Cbp/p300-interacting transactivator 2, Cited2 {Human (Homo sapiens) [TaxId: 9606]} gsgsgsgsnvidtdfideevlmslviemgldrikelpelwlgqnefdfmtdf
Timeline for d1p4qa_: