Lineage for d1p4qa_ (1p4q A:)

  1. Root: SCOPe 2.01
  2. 1072259Class j: Peptides [58231] (120 folds)
  3. 1073890Fold j.96: Transactivation domain [81275] (1 superfamily)
  4. 1073891Superfamily j.96.1: Transactivation domain [74800] (1 family) (S)
  5. 1073892Family j.96.1.1: Transactivation domain [74801] (2 proteins)
  6. 1073899Protein Cbp/p300-interacting transactivator 2, Cited2 [90295] (1 species)
  7. 1073900Species Human (Homo sapiens) [TaxId:9606] [90296] (2 PDB entries)
  8. 1073902Domain d1p4qa_: 1p4q A: [87777]
    Other proteins in same PDB: d1p4qb_
    complexed with TAZ1 domain of mouse CBP
    complexed with zn

Details for d1p4qa_

PDB Entry: 1p4q (more details)

PDB Description: solution structure of the cited2 transactivation domain in complex with the p300 ch1 domain
PDB Compounds: (A:) Cbp/p300-interacting transactivator 2

SCOPe Domain Sequences for d1p4qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4qa_ j.96.1.1 (A:) Cbp/p300-interacting transactivator 2, Cited2 {Human (Homo sapiens) [TaxId: 9606]}
gsgsgsgsnvidtdfideevlmslviemgldrikelpelwlgqnefdfmtdf

SCOPe Domain Coordinates for d1p4qa_:

Click to download the PDB-style file with coordinates for d1p4qa_.
(The format of our PDB-style files is described here.)

Timeline for d1p4qa_: