Lineage for d1p4ma_ (1p4m A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560964Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 561246Superfamily b.43.5: Riboflavin kinase-like [82114] (1 family) (S)
  5. 561247Family b.43.5.1: Riboflavin kinase-like [82115] (2 proteins)
  6. 561248Protein Riboflavin kinase [82116] (2 species)
  7. 561257Species Human (Homo sapiens) [TaxId:9606] [89338] (4 PDB entries)
    encoded by FLJ11149
  8. 561260Domain d1p4ma_: 1p4m A: [87774]
    complexed with adp, fmn, mg

Details for d1p4ma_

PDB Entry: 1p4m (more details), 1.8 Å

PDB Description: crystal structure of riboflavin kinase

SCOP Domain Sequences for d1p4ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4ma_ b.43.5.1 (A:) Riboflavin kinase {Human (Homo sapiens)}
rhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvhkm
vvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisaiqg
dieeakkrlelpeylkikednffqvsk

SCOP Domain Coordinates for d1p4ma_:

Click to download the PDB-style file with coordinates for d1p4ma_.
(The format of our PDB-style files is described here.)

Timeline for d1p4ma_: