SCOP 1.67: Domain d1p4kc_: 1p4k C:

Lineage for d1p4kc_ (1p4k C:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.5: (Glycosyl)asparaginase [56261] (1 protein)

6. Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (3 species)
   the precursor chain is cleaved onto 2 fragments by autoproteolysis

7. Species Flavobacterium meningosepticum [TaxId:238] [56264] (8 PDB entries)

8. Domain d1p4kc_: 1p4k C: [87773]
   precursor D151N mutant

Details for d1p4kc_

PDB Entry: 1p4k, 1.9 Å

PDB Description: crystal structure of the glycosylasparaginase precursor d151n mutant

SCOP Domain Sequences for d1p4kc_:

Sequence; same for both SEQRES and ATOM records:

>d1p4kc_ d.153.1.5 (C:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Flavobacterium meningosepticum}
ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
enlltaesekewkewlktsqykpivnienhntigmialdaqgnlsgacttsgmaykmhgr
vgdspiigaglfvdneigaatatghgeevirtvgthlvvelmnqgrtpqqackeaveriv
kivnrrgknlkdiqvgfialnkkgeygayciqdgfnfavhdqkgnrletpgfalk

Timeline for d1p4kc_:

• d1p4kc_ first appeared in SCOP 1.65
  
• d1p4kc_ appears in SCOP 1.69
  
• d1p4kc_ appears in the current release, SCOPe 2.08