Lineage for d1p4ed1 (1p4e D:2-130)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282277Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 282537Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) (S)
  5. 282538Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 282557Protein Flp recombinase [47829] (1 species)
  7. 282558Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47830] (3 PDB entries)
  8. 282562Domain d1p4ed1: 1p4e D:2-130 [87770]
    Other proteins in same PDB: d1p4ea2, d1p4eb2, d1p4ec2, d1p4ed2
    complexed with 2po, ptr; mutant

Details for d1p4ed1

PDB Entry: 1p4e (more details), 2.7 Å

PDB Description: flpe w330f mutant-dna holliday junction complex

SCOP Domain Sequences for d1p4ed1:

Sequence, based on SEQRES records: (download)

>d1p4ed1 a.60.9.1 (D:2-130) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae)}
sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyngqkhqsditdivs
slqlqfess

Sequence, based on observed residues (ATOM records): (download)

>d1p4ed1 a.60.9.1 (D:2-130) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae)}
sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipynsditdivsslqlq
fess

SCOP Domain Coordinates for d1p4ed1:

Click to download the PDB-style file with coordinates for d1p4ed1.
(The format of our PDB-style files is described here.)

Timeline for d1p4ed1: