Lineage for d1p4eb2 (1p4e B:136-423)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2557600Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 2557601Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 2557602Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)
  6. 2557653Protein Flp recombinase [56359] (1 species)
  7. 2557654Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56360] (3 PDB entries)
  8. 2557656Domain d1p4eb2: 1p4e B:136-423 [87767]
    Other proteins in same PDB: d1p4ea1, d1p4eb1, d1p4eb3, d1p4ec1, d1p4ed1
    protein/DNA complex; complexed with 2po; mutant

Details for d1p4eb2

PDB Entry: 1p4e (more details), 2.7 Å

PDB Description: Flpe W330F mutant-DNA Holliday Junction Complex
PDB Compounds: (B:) Recombinase FLP protein

SCOPe Domain Sequences for d1p4eb2:

Sequence, based on SEQRES records: (download)

>d1p4eb2 d.163.1.1 (B:136-423) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gnshskkmlkallsegesiweitekilnsfeytsrftktktlyqflflatfincgrfsdi
knvdpksfklvqnkylgviiqclvtetktsvsrhiyffsargridplvyldeflrnsepv
lkrvnrtgnsssnkqeyqllkdnlvrsynkalkknapypifaikngpkshigrhlmtsfl
smkglteltnvvgnfsdkrasavarttythqitaipdhyfalvsryyaydpiskemialk
detnpieewqhieqlkgsaegsirypawngiisqevldylssyinrri

Sequence, based on observed residues (ATOM records): (download)

>d1p4eb2 d.163.1.1 (B:136-423) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gnshskkmlkallsegesiweitekilnsfeytsrftktktlyqflflatfincgrfsdi
knvdpksfklvqnkylgviiqclvtetktsvsrhiyffsargridplvyldeflrnsepv
lkrvnrtgnsssnkqeyqllkdnlvrsynkalkknapypifaikngpkshigrhlmtsfl
smkglteltnvvgnfsdttythqitaipdhyfalvsryyaydpiskemialkdetnpiee
wqhieqlkgsaegsirypawngiisqevldylssyinrri

SCOPe Domain Coordinates for d1p4eb2:

Click to download the PDB-style file with coordinates for d1p4eb2.
(The format of our PDB-style files is described here.)

Timeline for d1p4eb2: