Lineage for d1p4eb1 (1p4e B:2-129)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999381Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families) (S)
  5. 1999382Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 protein domains)
  6. 1999433Protein Flp recombinase [47829] (1 species)
  7. 1999434Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47830] (3 PDB entries)
  8. 1999436Domain d1p4eb1: 1p4e B:2-129 [87766]
    Other proteins in same PDB: d1p4ea2, d1p4eb2, d1p4eb3, d1p4ec2, d1p4ed2
    protein/DNA complex; complexed with 2po; mutant

Details for d1p4eb1

PDB Entry: 1p4e (more details), 2.7 Å

PDB Description: Flpe W330F mutant-DNA Holliday Junction Complex
PDB Compounds: (B:) Recombinase FLP protein

SCOPe Domain Sequences for d1p4eb1:

Sequence, based on SEQRES records: (download)

>d1p4eb1 a.60.9.1 (B:2-129) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyngqkhqsditdivs
slqlqfes

Sequence, based on observed residues (ATOM records): (download)

>d1p4eb1 a.60.9.1 (B:2-129) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyngqksditdivssl
qlqfes

SCOPe Domain Coordinates for d1p4eb1:

Click to download the PDB-style file with coordinates for d1p4eb1.
(The format of our PDB-style files is described here.)

Timeline for d1p4eb1: