Lineage for d1p4ea1 (1p4e A:2-129)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539305Fold a.60: SAM domain-like [47768] (14 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 539637Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) (S)
  5. 539638Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 539683Protein Flp recombinase [47829] (1 species)
  7. 539684Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47830] (3 PDB entries)
  8. 539685Domain d1p4ea1: 1p4e A:2-129 [87764]
    Other proteins in same PDB: d1p4ea2, d1p4eb2, d1p4ec2, d1p4ed2

Details for d1p4ea1

PDB Entry: 1p4e (more details), 2.7 Å

PDB Description: flpe w330f mutant-dna holliday junction complex

SCOP Domain Sequences for d1p4ea1:

Sequence, based on SEQRES records: (download)

>d1p4ea1 a.60.9.1 (A:2-129) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae)}
sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyngqkhqsditdivs
slqlqfes

Sequence, based on observed residues (ATOM records): (download)

>d1p4ea1 a.60.9.1 (A:2-129) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae)}
sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyngqsditdivsslq
lqfes

SCOP Domain Coordinates for d1p4ea1:

Click to download the PDB-style file with coordinates for d1p4ea1.
(The format of our PDB-style files is described here.)

Timeline for d1p4ea1: