Lineage for d1p3wb_ (1p3w B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131551Protein Cysteine desulfurase IscS [89755] (1 species)
  7. 2131552Species Escherichia coli [TaxId:562] [89756] (1 PDB entry)
  8. 2131554Domain d1p3wb_: 1p3w B: [87753]
    complexed with plp

Details for d1p3wb_

PDB Entry: 1p3w (more details), 2.1 Å

PDB Description: X-ray crystal structure of E. coli IscS
PDB Compounds: (B:) Cysteine desulfurase

SCOPe Domain Sequences for d1p3wb_:

Sequence, based on SEQRES records: (download)

>d1p3wb_ c.67.1.3 (B:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]}
klpiyldysattpvdprvaekmmqfmtmdgtfgnpasrshrfgwqaeeavdiarnqiadl
vgadpreivftsgatesdnlaikgaanfyqkkgkhiitsktehkavldtcrqleregfev
tylapqrngiidlkeleaamrddtilvsimhvnneigvvqdiaaigemcrargiiyhvda
tqsvgklpidlsqlkvdlmsfsghkiygpkgigalyvrrkprvrieaqmhggghergmrs
gtlpvhqivgmgeayriakeematemerlrglrnrlwngikdieevylngdlehgapnil
nvsfnyvegeslimalkdlavssgsactsaslepsyvlralglndelahssirfslgrft
teeeidytielvrksigrlrdlsplwemykq

Sequence, based on observed residues (ATOM records): (download)

>d1p3wb_ c.67.1.3 (B:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]}
klpiyldysattpvdprvaekmmqfmtmdgtfgnpasrshrfgwqaeeavdiarnqiadl
vgadpreivftsgatesdnlaikgaanfyqkkgkhiitsktehkavldtcrqleregfev
tylapqrngiidlkeleaamrddtilvsimhvnneigvvqdiaaigemcrargiiyhvda
tqsvgklpidlsqlkvdlmsfsghkiygpkgigalyvrrkprvrieaqmhggghergmrs
gtlpvhqivgmgeayriakeematemerlrglrnrlwngikdieevylngdlehgapnil
nvsfnyvegeslimalkdlavssgsaepsyvlralglndelahssirfslgrftteeeid
ytielvrksigrlrdlsplwemykq

SCOPe Domain Coordinates for d1p3wb_:

Click to download the PDB-style file with coordinates for d1p3wb_.
(The format of our PDB-style files is described here.)

Timeline for d1p3wb_: