Lineage for d1p3qr_ (1p3q R:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439425Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 439449Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 439490Family a.5.2.4: CUE domain [88995] (2 proteins)
  6. 439494Protein Vacuolar protein sorting-associated protein vps9 [88996] (1 species)
  7. 439495Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88997] (2 PDB entries)
  8. 439498Domain d1p3qr_: 1p3q R: [87749]
    Other proteins in same PDB: d1p3qu_, d1p3qv_
    partly disordered, helix-swapped homodimer

Details for d1p3qr_

PDB Entry: 1p3q (more details), 1.7 Å

PDB Description: mechanism of ubiquitin recognition by the cue domain of vps9

SCOP Domain Sequences for d1p3qr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3qr_ a.5.2.4 (R:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae)}
lqnmfpdmdpsliedvciaaasrigpcvdallslse

SCOP Domain Coordinates for d1p3qr_:

Click to download the PDB-style file with coordinates for d1p3qr_.
(The format of our PDB-style files is described here.)

Timeline for d1p3qr_: