Lineage for d1p3qq_ (1p3q Q:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534233Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 534257Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 534319Family a.5.2.4: CUE domain [88995] (3 proteins)
    Pfam 02845
  6. 534326Protein Vacuolar protein sorting-associated protein vps9 [88996] (1 species)
  7. 534327Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88997] (2 PDB entries)
  8. 534329Domain d1p3qq_: 1p3q Q: [87748]
    Other proteins in same PDB: d1p3qu_, d1p3qv_

Details for d1p3qq_

PDB Entry: 1p3q (more details), 1.7 Å

PDB Description: mechanism of ubiquitin recognition by the cue domain of vps9

SCOP Domain Sequences for d1p3qq_:

Sequence, based on SEQRES records: (download)

>d1p3qq_ a.5.2.4 (Q:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae)}
sslikkieenerkdtlntlqnmfpdmdpsliedvciaaasrigpcvd

Sequence, based on observed residues (ATOM records): (download)

>d1p3qq_ a.5.2.4 (Q:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae)}
sslikkieenerkdtlntlqnmfpdmdpsliedvciaaasgpcvd

SCOP Domain Coordinates for d1p3qq_:

Click to download the PDB-style file with coordinates for d1p3qq_.
(The format of our PDB-style files is described here.)

Timeline for d1p3qq_: