Lineage for d1p3hn_ (1p3h N:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666133Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 666134Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 666135Family b.35.1.1: GroES [50130] (2 proteins)
  6. 666136Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 666195Species Mycobacterium tuberculosis [TaxId:1773] [63753] (2 PDB entries)
  8. 666209Domain d1p3hn_: 1p3h N: [87747]
    complexed with ca, mpd

Details for d1p3hn_

PDB Entry: 1p3h (more details), 2.8 Å

PDB Description: crystal structure of the mycobacterium tuberculosis chaperonin 10 tetradecamer
PDB Compounds: (N:) 10 kda chaperonin

SCOP Domain Sequences for d1p3hn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3hn_ b.35.1.1 (N:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]}
akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl
dvaegdtviyskyggteikyngeeylilsardvlavvsk

SCOP Domain Coordinates for d1p3hn_:

Click to download the PDB-style file with coordinates for d1p3hn_.
(The format of our PDB-style files is described here.)

Timeline for d1p3hn_: