Lineage for d1p3hk_ (1p3h K:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558060Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 558061Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 558062Family b.35.1.1: GroES [50130] (2 proteins)
  6. 558063Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 558094Species Mycobacterium tuberculosis [TaxId:1773] [63753] (2 PDB entries)
  8. 558105Domain d1p3hk_: 1p3h K: [87744]

Details for d1p3hk_

PDB Entry: 1p3h (more details), 2.8 Å

PDB Description: crystal structure of the mycobacterium tuberculosis chaperonin 10 tetradecamer

SCOP Domain Sequences for d1p3hk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3hk_ b.35.1.1 (K:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis}
kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld
vaegdtviyskyggteikyngeeylilsardvlavvsk

SCOP Domain Coordinates for d1p3hk_:

Click to download the PDB-style file with coordinates for d1p3hk_.
(The format of our PDB-style files is described here.)

Timeline for d1p3hk_: