Class b: All beta proteins [48724] (176 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) |
Family b.35.1.1: GroES [50130] (2 proteins) automatically mapped to Pfam PF00166 |
Protein Chaperonin-10 (GroES) [50131] (4 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [63753] (2 PDB entries) |
Domain d1p3hf_: 1p3h F: [87739] complexed with ca, mpd |
PDB Entry: 1p3h (more details), 2.8 Å
SCOPe Domain Sequences for d1p3hf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3hf_ b.35.1.1 (F:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]} akvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripl dvaegdtviyskyggteikyngeeylilsardvlavvsk
Timeline for d1p3hf_: