Lineage for d1p3hb_ (1p3h B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296128Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 296129Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 296130Family b.35.1.1: GroES [50130] (2 proteins)
  6. 296131Protein Chaperonin-10 (GroES) [50131] (3 species)
  7. 296148Species Mycobacterium tuberculosis [TaxId:1773] [63753] (2 PDB entries)
  8. 296150Domain d1p3hb_: 1p3h B: [87735]

Details for d1p3hb_

PDB Entry: 1p3h (more details), 2.8 Å

PDB Description: crystal structure of the mycobacterium tuberculosis chaperonin 10 tetradecamer

SCOP Domain Sequences for d1p3hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3hb_ b.35.1.1 (B:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis}
kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld
vaegdtviyskyggteikyngeeylilsardvlavvsk

SCOP Domain Coordinates for d1p3hb_:

Click to download the PDB-style file with coordinates for d1p3hb_.
(The format of our PDB-style files is described here.)

Timeline for d1p3hb_: