Lineage for d1p3db2 (1p3d B:322-473)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489723Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 489724Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 489725Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)
  6. 489730Protein UDP-N-acetylmuramate-alanine ligase MurC [82452] (2 species)
  7. 489731Species Haemophilus influenzae [TaxId:727] [89727] (4 PDB entries)
  8. 489733Domain d1p3db2: 1p3d B:322-473 [87732]
    Other proteins in same PDB: d1p3da1, d1p3da3, d1p3db1, d1p3db3

Details for d1p3db2

PDB Entry: 1p3d (more details), 1.7 Å

PDB Description: Crystal Structure of UDP-N-acetylmuramic acid:L-alanine ligase (MurC) in Complex with UMA and ANP.

SCOP Domain Sequences for d1p3db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3db2 c.59.1.1 (B:322-473) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae}
gagrrfdqlgefirpngkvrlvddyghhptevgvtikaaregwgdkrivmifqphrysrt
rdlfddfvqvlsqvdalimldvyaageapivgadskslcrsirnlgkvdpilvsdtsqlg
dvldqiiqdgdlilaqgagsvskisrglaesw

SCOP Domain Coordinates for d1p3db2:

Click to download the PDB-style file with coordinates for d1p3db2.
(The format of our PDB-style files is described here.)

Timeline for d1p3db2: