Lineage for d1p3da1 (1p3d A:11-106)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 576986Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 576987Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family) (S)
  5. 576988Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. 576989Protein UDP-N-acetylmuramate-alanine ligase MurC [82315] (2 species)
  7. 576990Species Haemophilus influenzae [TaxId:727] [89549] (4 PDB entries)
  8. 576991Domain d1p3da1: 1p3d A:11-106 [87728]
    Other proteins in same PDB: d1p3da2, d1p3da3, d1p3db2, d1p3db3

Details for d1p3da1

PDB Entry: 1p3d (more details), 1.7 Å

PDB Description: Crystal Structure of UDP-N-acetylmuramic acid:L-alanine ligase (MurC) in Complex with UMA and ANP.

SCOP Domain Sequences for d1p3da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae}
iipemrrvqqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrlaqagakiyigh
aeehiegasvvvvssaikddnpelvtskqkripviq

SCOP Domain Coordinates for d1p3da1:

Click to download the PDB-style file with coordinates for d1p3da1.
(The format of our PDB-style files is described here.)

Timeline for d1p3da1: