Lineage for d1p31b1 (1p31 B:9-106)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1833628Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 1833629Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 1833630Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. 1833631Protein UDP-N-acetylmuramate-alanine ligase MurC [82315] (2 species)
  7. 1833632Species Haemophilus influenzae [TaxId:727] [89549] (4 PDB entries)
  8. 1833636Domain d1p31b1: 1p31 B:9-106 [87725]
    Other proteins in same PDB: d1p31a2, d1p31a3, d1p31b2, d1p31b3
    complexed with epu, mg

Details for d1p31b1

PDB Entry: 1p31 (more details), 1.85 Å

PDB Description: Crystal Structure of UDP-N-acetylmuramic acid:L-alanine Ligase (MurC) from Haemophilus influenzae
PDB Compounds: (B:) UDP-N-acetylmuramate--alanine ligase

SCOPe Domain Sequences for d1p31b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p31b1 c.5.1.1 (B:9-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}
rkiipemrrvqqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrlaqagakiyi
ghaeehiegasvvvvssaikddnpelvtskqkripviq

SCOPe Domain Coordinates for d1p31b1:

Click to download the PDB-style file with coordinates for d1p31b1.
(The format of our PDB-style files is described here.)

Timeline for d1p31b1: