Lineage for d1p31a3 (1p31 A:107-321)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 492652Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 492775Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families) (S)
    has extra strand located between strands 1 and 2
  5. 492776Family c.72.2.1: MurCDEF [53624] (4 proteins)
  6. 492781Protein UDP-N-acetylmuramate-alanine ligase MurC [82520] (2 species)
  7. 492782Species Haemophilus influenzae [TaxId:727] [89776] (4 PDB entries)
  8. 492787Domain d1p31a3: 1p31 A:107-321 [87724]
    Other proteins in same PDB: d1p31a1, d1p31a2, d1p31b1, d1p31b2

Details for d1p31a3

PDB Entry: 1p31 (more details), 1.85 Å

PDB Description: Crystal Structure of UDP-N-acetylmuramic acid:L-alanine Ligase (MurC) from Haemophilus influenzae

SCOP Domain Sequences for d1p31a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p31a3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae}
raqmlaeimrfrhgiavagthgkttttamismiytqakldptfvngglvksagknahlga
sryliaeadesdasflhlqpmvsvvtnmepdhmdtyegdfekmkatyvkflhnlpfygla
vmcaddpvlmelvpkvgrqvitygfseqadyriedyeqtgfqghytvicpnnerinvlln
vpgkhnalnataalavakeegianeailealadfq

SCOP Domain Coordinates for d1p31a3:

Click to download the PDB-style file with coordinates for d1p31a3.
(The format of our PDB-style files is described here.)

Timeline for d1p31a3: