SCOP 1.65: Domain d1p31a3: 1p31 A:107-321

Lineage for d1p31a3 (1p31 A:107-321)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.72: Ribokinase-like [53612] (2 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families)
   has extra strand located between strands 1 and 2

5. Family c.72.2.1: MurCDEF [53624] (4 proteins)

6. Protein UDP-N-acetylmuramate-alanine ligase MurC [82520] (2 species)

7. Species Haemophilus influenzae [TaxId:727] [89776] (4 PDB entries)

8. Domain d1p31a3: 1p31 A:107-321 [87724]
   Other proteins in same PDB: d1p31a1, d1p31a2, d1p31b1, d1p31b2

Details for d1p31a3

PDB Entry: 1p31, 1.85 Å

PDB Description: Crystal Structure of UDP-N-acetylmuramic acid:L-alanine Ligase (MurC) from Haemophilus influenzae

SCOP Domain Sequences for d1p31a3:

Sequence; same for both SEQRES and ATOM records:

>d1p31a3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae}
raqmlaeimrfrhgiavagthgkttttamismiytqakldptfvngglvksagknahlga
sryliaeadesdasflhlqpmvsvvtnmepdhmdtyegdfekmkatyvkflhnlpfygla
vmcaddpvlmelvpkvgrqvitygfseqadyriedyeqtgfqghytvicpnnerinvlln
vpgkhnalnataalavakeegianeailealadfq

Timeline for d1p31a3:

• d1p31a3 is new in SCOP 1.65
  
• d1p31a3 appears in SCOP 1.67
  
• d1p31a3 appears in the current release, SCOPe 2.08