SCOPe 2.03: Domain d1p2fa2: 1p2f A:1-120

Lineage for d1p2fa2 (1p2f A:1-120)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Response regulator DrrB [89587] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [89588] (1 PDB entry)

8. Domain d1p2fa2: 1p2f A:1-120 [87721]
   Other proteins in same PDB: d1p2fa1

Details for d1p2fa2

PDB Entry: 1p2f, 1.8 Å

PDB Description: crystal structure analysis of response regulator drrb, a thermotoga maritima ompr/phob homolog

PDB Compounds: (A:) Response regulator

SCOPe Domain Sequences for d1p2fa2:

Sequence; same for both SEQRES and ATOM records:

>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]}
mmwkiavvdddknilkkvseklqqlgrvktfltgedflndeeafhvvvldvmlpdysgye
icrmiketrpetwvilltllsddesvlkgfeagaddyvtkpfnpeillarvkrflerekk

Timeline for d1p2fa2:

• d1p2fa2 first appeared in SCOP 1.65
  
• d1p2fa2 appears in SCOPe 2.02
  
• d1p2fa2 appears in SCOPe 2.04
  
• d1p2fa2 appears in the current release, SCOPe 2.08