Lineage for d1p22b2 (1p22 B:2-59)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410976Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 410977Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 410978Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 410990Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)
  7. 410991Species Human (Homo sapiens) [TaxId:9606] [54711] (5 PDB entries)
  8. 410996Domain d1p22b2: 1p22 B:2-59 [87718]
    Other proteins in same PDB: d1p22a1, d1p22a2, d1p22b1
    complexed with sep

Details for d1p22b2

PDB Entry: 1p22 (more details), 2.95 Å

PDB Description: Structure of a beta-TrCP1-Skp1-beta-catenin complex: destruction motif binding and lysine specificity on the SCFbeta-TrCP1 ubiquitin ligase

SCOP Domain Sequences for d1p22b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p22b2 d.42.1.1 (B:2-59) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthh

SCOP Domain Coordinates for d1p22b2:

Click to download the PDB-style file with coordinates for d1p22b2.
(The format of our PDB-style files is described here.)

Timeline for d1p22b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p22b1