Lineage for d1p22b1 (1p22 B:64-136)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348494Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2348495Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2348496Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 2348503Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)
  7. 2348504Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries)
  8. 2348521Domain d1p22b1: 1p22 B:64-136 [87717]
    Other proteins in same PDB: d1p22a1, d1p22a2, d1p22a3, d1p22b2

Details for d1p22b1

PDB Entry: 1p22 (more details), 2.95 Å

PDB Description: Structure of a beta-TrCP1-Skp1-beta-catenin complex: destruction motif binding and lysine specificity on the SCFbeta-TrCP1 ubiquitin ligase
PDB Compounds: (B:) skp1

SCOPe Domain Sequences for d1p22b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p22b1 a.157.1.1 (B:64-136) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrken

SCOPe Domain Coordinates for d1p22b1:

Click to download the PDB-style file with coordinates for d1p22b1.
(The format of our PDB-style files is described here.)

Timeline for d1p22b1: