Lineage for d1p22a2 (1p22 A:253-545)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418399Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2418400Family b.69.4.1: WD40-repeat [50979] (17 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 2418508Protein F-box/WD-repeat protein 1 (beta-TRCP1) [89376] (1 species)
  7. 2418509Species Human (Homo sapiens) [TaxId:9606] [89377] (1 PDB entry)
  8. 2418510Domain d1p22a2: 1p22 A:253-545 [87716]
    Other proteins in same PDB: d1p22a1, d1p22a3, d1p22b1, d1p22b2

Details for d1p22a2

PDB Entry: 1p22 (more details), 2.95 Å

PDB Description: Structure of a beta-TrCP1-Skp1-beta-catenin complex: destruction motif binding and lysine specificity on the SCFbeta-TrCP1 ubiquitin ligase
PDB Compounds: (A:) F-box/WD-repeat protein 1A

SCOPe Domain Sequences for d1p22a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}
grhslqrihcrsetskgvyclqyddqkivsglrdntikiwdkntleckriltghtgsvlc
lqyderviitgssdstvrvwdvntgemlntlihhceavlhlrfnngmmvtcskdrsiavw
dmasptditlrrvlvghraavnvvdfddkyivsasgdrtikvwntstcefvrtlnghkrg
iaclqyrdrlvvsgssdntirlwdiecgaclrvlegheelvrcirfdnkrivsgaydgki
kvwdlvaaldprapagtlclrtlvehsgrvfrlqfdefqivssshddtiliwd

SCOPe Domain Coordinates for d1p22a2:

Click to download the PDB-style file with coordinates for d1p22a2.
(The format of our PDB-style files is described here.)

Timeline for d1p22a2: