Lineage for d1p1ra2 (1p1r A:164-339)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. Protein Alcohol dehydrogenase [51737] (9 species)
  7. Species Horse (Equus caballus) [TaxId:9796] [51738] (52 PDB entries)
    Uniprot P00327
  8. Domain d1p1ra2: 1p1r A:164-339 [87704]
    Other proteins in same PDB: d1p1ra1, d1p1rb1, d1p1rc1, d1p1rd1
    complexed with mpd, nai, nmh, zn

Details for d1p1ra2

PDB Entry: 1p1r (more details), 1.57 Å

PDB Description: Horse liver alcohol dehydrogenase complexed with NADH and R-N-1-methylhexylformamide
PDB Compounds: (A:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d1p1ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1ra2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

SCOPe Domain Coordinates for d1p1ra2 are not available.

Timeline for d1p1ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p1ra1
View in 3D
Domains from other chains:
(mouse over for more information)
d1p1rb1, d1p1rb2, d1p1rc1, d1p1rc2, d1p1rd1, d1p1rd2