Lineage for d1p1ma2 (1p1m A:50-330)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1341467Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1341858Family c.1.9.9: SAH/MTA deaminase-like [82258] (3 proteins)
    automatically mapped to Pfam PF01979
  6. 1341871Protein Hypothetical protein TM0936, probable catalytic domain [82259] (1 species)
  7. 1341872Species Thermotoga maritima [TaxId:2336] [82260] (3 PDB entries)
  8. 1341873Domain d1p1ma2: 1p1m A:50-330 [87697]
    Other proteins in same PDB: d1p1ma1
    structural genomics
    complexed with met, ni

Details for d1p1ma2

PDB Entry: 1p1m (more details), 1.5 Å

PDB Description: structure of thermotoga maritima amidohydrolase tm0936 bound to ni and methionine
PDB Compounds: (A:) Hypothetical protein TM0936

SCOPe Domain Sequences for d1p1ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1ma2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima [TaxId: 2336]}
alfnththapmtllrgvaedlsfeewlfskvlpiedrltekmayygtilaqmemarhgia
gfvdmyfheewiakavrdfgmralltrglvdsngddggrleenlklynewngfegrifvg
fgphspylcseeylkrvfdtakslnapvtihlyetskeeydledilniglkevktiaahc
vhlperyfgvlkdipffvshnpasnlklgngiapvqrmiehgmkvtlgtdgaasnnslnl
ffemrlasllqkaqnprnldvntclkmvtydgaqamgfksg

SCOPe Domain Coordinates for d1p1ma2:

Click to download the PDB-style file with coordinates for d1p1ma2.
(The format of our PDB-style files is described here.)

Timeline for d1p1ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p1ma1