Class b: All beta proteins [48724] (176 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.4: SAH/MTA deaminase-like [82224] (3 proteins) |
Protein Hypothetical protein TM0936 [82225] (1 species) |
Species Thermotoga maritima [TaxId:2336] [82226] (3 PDB entries) |
Domain d1p1ma1: 1p1m A:1-49,A:331-404 [87696] Other proteins in same PDB: d1p1ma2 structural genomics complexed with met, ni |
PDB Entry: 1p1m (more details), 1.5 Å
SCOPe Domain Sequences for d1p1ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p1ma1 b.92.1.4 (A:1-49,A:331-404) Hypothetical protein TM0936 {Thermotoga maritima [TaxId: 2336]} miignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvmpXkieegwnadl vvidldlpemfpvqniknhlvhafsgevfatmvagkwiyfdgeyptidseevkrelarie kely
Timeline for d1p1ma1: