SCOP 1.71: Domain d1p1ma1: 1p1m A:1-49,A:331-404

Lineage for d1p1ma1 (1p1m A:1-49,A:331-404)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.4: Hypothetical protein TM0936 [82224] (1 protein)

6. Protein Hypothetical protein TM0936 [82225] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [82226] (2 PDB entries)

8. Domain d1p1ma1: 1p1m A:1-49,A:331-404 [87696]
   Other proteins in same PDB: d1p1ma2
   structural genomics
   complexed with met, ni

Details for d1p1ma1

PDB Entry: 1p1m, 1.5 Å

PDB Description: structure of thermotoga maritima amidohydrolase tm0936 bound to ni and methionine

SCOP Domain Sequences for d1p1ma1:

Sequence; same for both SEQRES and ATOM records:

>d1p1ma1 b.92.1.4 (A:1-49,A:331-404) Hypothetical protein TM0936 {Thermotoga maritima}
miignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvmpXkieegwnadl
vvidldlpemfpvqniknhlvhafsgevfatmvagkwiyfdgeyptidseevkrelarie
kely

Timeline for d1p1ma1:

• d1p1ma1 first appeared in SCOP 1.65
  
• d1p1ma1 appears in SCOP 1.69
  
• d1p1ma1 appears in SCOP 1.73
  
• d1p1ma1 appears in the current release, SCOPe 2.08