Lineage for d1p1ma1 (1p1m A:1-49,A:331-404)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304009Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 304010Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 304087Family b.92.1.4: Hypothetical protein TM0936 [82224] (1 protein)
  6. 304088Protein Hypothetical protein TM0936 [82225] (1 species)
  7. 304089Species Thermotoga maritima [TaxId:243274] [82226] (2 PDB entries)
  8. 304090Domain d1p1ma1: 1p1m A:1-49,A:331-404 [87696]
    Other proteins in same PDB: d1p1ma2
    structural genomics
    complexed with met, ni

Details for d1p1ma1

PDB Entry: 1p1m (more details), 1.5 Å

PDB Description: structure of thermotoga maritima amidohydrolase tm0936 bound to ni and methionine

SCOP Domain Sequences for d1p1ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1ma1 b.92.1.4 (A:1-49,A:331-404) Hypothetical protein TM0936 {Thermotoga maritima}
miignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvmpXkieegwnadl
vvidldlpemfpvqniknhlvhafsgevfatmvagkwiyfdgeyptidseevkrelarie
kely

SCOP Domain Coordinates for d1p1ma1:

Click to download the PDB-style file with coordinates for d1p1ma1.
(The format of our PDB-style files is described here.)

Timeline for d1p1ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p1ma2