Lineage for d1p1la_ (1p1l A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504343Superfamily d.58.5: GlnB-like [54913] (4 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 504374Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)
  6. 504375Protein Cut A1 [89931] (4 species)
  7. 504376Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [89933] (1 PDB entry)
  8. 504377Domain d1p1la_: 1p1l A: [87695]
    structural genomics

Details for d1p1la_

PDB Entry: 1p1l (more details), 2 Å

PDB Description: structure of the periplasmic divalent cation tolerance protein cuta from archaeoglobus fulgidus

SCOP Domain Sequences for d1p1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1la_ d.58.5.2 (A:) Cut A1 {Archaeon Archaeoglobus fulgidus}
mhnfiyitapsleeaeriakrllekklaacvnifpiksffwwegkieaatefamivktrs
ekfaevrdevkamhsyttpcicaipierglkefldwidetve

SCOP Domain Coordinates for d1p1la_:

Click to download the PDB-style file with coordinates for d1p1la_.
(The format of our PDB-style files is described here.)

Timeline for d1p1la_: