Lineage for d1p1kb2 (1p1k B:323-437)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331066Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 331067Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 331255Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (5 proteins)
  6. 331292Protein Myo-inositol 1-phosphate synthase [75484] (2 species)
  7. 331293Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (8 PDB entries)
  8. 331301Domain d1p1kb2: 1p1k B:323-437 [87694]
    Other proteins in same PDB: d1p1ka1, d1p1kb1
    complexed with nai

Details for d1p1kb2

PDB Entry: 1p1k (more details), 2.1 Å

PDB Description: Crystal structure of the 1L-myo-inositol 1-phosphate synthase complexed with NADH in the presence of EDTA

SCOP Domain Sequences for d1p1kb2:

Sequence, based on SEQRES records: (download)

>d1p1kb2 d.81.1.3 (B:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia
sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

Sequence, based on observed residues (ATOM records): (download)

>d1p1kb2 d.81.1.3 (B:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeividdiiasndi
lyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

SCOP Domain Coordinates for d1p1kb2:

Click to download the PDB-style file with coordinates for d1p1kb2.
(The format of our PDB-style files is described here.)

Timeline for d1p1kb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p1kb1