SCOP 1.69: Domain d1p1jb2: 1p1j B:323-437

Lineage for d1p1jb2 (1p1j B:323-437)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)

6. Protein Myo-inositol 1-phosphate synthase [75484] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (9 PDB entries)

8. Domain d1p1jb2: 1p1j B:323-437 [87690]
   Other proteins in same PDB: d1p1ja1, d1p1jb1

Details for d1p1jb2

PDB Entry: 1p1j, 1.7 Å

PDB Description: Crystal structure of the 1L-myo-inositol 1-phosphate synthase complexed with NADH

SCOP Domain Sequences for d1p1jb2:

Sequence; same for both SEQRES and ATOM records:

>d1p1jb2 d.81.1.3 (B:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia
sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

Timeline for d1p1jb2:

• d1p1jb2 first appeared in SCOP 1.65
  
• d1p1jb2 appears in SCOP 1.67
  
• d1p1jb2 appears in SCOP 1.71
  
• d1p1jb2 appears in the current release, SCOPe 2.08