Lineage for d1p1ia1 (1p1i A:9-322,A:438-533)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575085Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 575433Protein Myo-inositol 1-phosphate synthase [75105] (4 species)
  7. 575439Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75107] (9 PDB entries)
  8. 575456Domain d1p1ia1: 1p1i A:9-322,A:438-533 [87683]
    Other proteins in same PDB: d1p1ia2, d1p1ib2

Details for d1p1ia1

PDB Entry: 1p1i (more details), 2.4 Å

PDB Description: Crystal structure of the NAD+-bound 1L-myo-inositol 1-phosphate synthase

SCOP Domain Sequences for d1p1ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1ia1 c.2.1.3 (A:9-322,A:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
itsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgi
mliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvya
pfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyyp
dfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtante
ryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvql
aehegtfiagddlkXdsllatpliidllvmtefctrvsykkvdpvkedagkfenfypvlt
flsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll

SCOP Domain Coordinates for d1p1ia1:

Click to download the PDB-style file with coordinates for d1p1ia1.
(The format of our PDB-style files is described here.)

Timeline for d1p1ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p1ia2