SCOP 1.65: Domain d1p1ia1: 1p1i A:9-322,A:438-533

Lineage for d1p1ia1 (1p1i A:9-322,A:438-533)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Myo-inositol 1-phosphate synthase [75105] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75107] (8 PDB entries)

8. Domain d1p1ia1: 1p1i A:9-322,A:438-533 [87683]
   Other proteins in same PDB: d1p1ia2, d1p1ib2

Details for d1p1ia1

PDB Entry: 1p1i, 2.4 Å

PDB Description: Crystal structure of the NAD+-bound 1L-myo-inositol 1-phosphate synthase

SCOP Domain Sequences for d1p1ia1:

Sequence; same for both SEQRES and ATOM records:

>d1p1ia1 c.2.1.3 (A:9-322,A:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
itsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgi
mliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvya
pfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyyp
dfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtante
ryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvql
aehegtfiagddlkXdsllatpliidllvmtefctrvsykkvdpvkedagkfenfypvlt
flsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll

Timeline for d1p1ia1:

• d1p1ia1 is new in SCOP 1.65
  
• d1p1ia1 appears in SCOP 1.67
  
• d1p1ia1 appears in the current release, SCOPe 2.08