Lineage for d1p1hd2 (1p1h D:323-437)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606541Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 606542Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 606790Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 606857Protein Myo-inositol 1-phosphate synthase [75484] (4 species)
  7. 606863Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (9 PDB entries)
  8. 606869Domain d1p1hd2: 1p1h D:323-437 [87682]
    Other proteins in same PDB: d1p1ha1, d1p1hb1, d1p1hc1, d1p1hd1
    complexed with nad

Details for d1p1hd2

PDB Entry: 1p1h (more details), 1.95 Å

PDB Description: Crystal structure of the 1L-myo-inositol/NAD+ complex

SCOP Domain Sequences for d1p1hd2:

Sequence, based on SEQRES records: (download)

>d1p1hd2 d.81.1.3 (D:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia
sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

Sequence, based on observed residues (ATOM records): (download)

>d1p1hd2 d.81.1.3 (D:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsiiasndilynddskvamdeyy
selmlgghnrisihnvce

SCOP Domain Coordinates for d1p1hd2:

Click to download the PDB-style file with coordinates for d1p1hd2.
(The format of our PDB-style files is described here.)

Timeline for d1p1hd2: