![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
![]() | Protein Myo-inositol 1-phosphate synthase [75484] (4 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (9 PDB entries) |
![]() | Domain d1p1hd2: 1p1h D:323-437 [87682] Other proteins in same PDB: d1p1ha1, d1p1hb1, d1p1hc1, d1p1hd1 complexed with nad |
PDB Entry: 1p1h (more details), 1.95 Å
SCOP Domain Sequences for d1p1hd2:
Sequence, based on SEQRES records: (download)
>d1p1hd2 d.81.1.3 (D:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)} sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce
>d1p1hd2 d.81.1.3 (D:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)} sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsiiasndilynddskvamdeyy selmlgghnrisihnvce
Timeline for d1p1hd2: