Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
Protein Myo-inositol 1-phosphate synthase [75484] (4 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (9 PDB entries) |
Domain d1p1hc2: 1p1h C:323-437 [87680] Other proteins in same PDB: d1p1ha1, d1p1hb1, d1p1hc1, d1p1hd1 |
PDB Entry: 1p1h (more details), 1.95 Å
SCOP Domain Sequences for d1p1hc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p1hc2 d.81.1.3 (C:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)} sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce
Timeline for d1p1hc2: