Lineage for d1p16b1 (1p16 B:246-389)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 800177Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)
  6. 800192Protein mRNA capping enzyme alpha subunit [89330] (1 species)
  7. 800193Species Yeast (Candida albicans) [TaxId:5476] [89331] (1 PDB entry)
  8. 800195Domain d1p16b1: 1p16 B:246-389 [87663]
    Other proteins in same PDB: d1p16a2, d1p16b2
    complexed with the phosphorylated carboxyl-terminal peptide of RNA polymerase II, chains C and D
    complexed with g, gtp, mse, po4, sep; mutant

Details for d1p16b1

PDB Entry: 1p16 (more details), 2.7 Å

PDB Description: Structure of an mRNA capping enzyme bound to the phosphorylated carboxyl-terminal domain of RNA polymerase II
PDB Compounds: (B:) mRNA capping enzyme alpha subunit

SCOP Domain Sequences for d1p16b1:

Sequence, based on SEQRES records: (download)

>d1p16b1 b.40.4.6 (B:246-389) mRNA capping enzyme alpha subunit {Yeast (Candida albicans) [TaxId: 5476]}
eentvdfqlefvfnevqdpdlderdptstyldydakpnliklrvwqgsnvhtdfakldls
dddwerlkaleqplqgriaecrqsttkkgywemlrfrndksngnhisvvekilvsikdgv
kekeviewcpkisrawkkrendrr

Sequence, based on observed residues (ATOM records): (download)

>d1p16b1 b.40.4.6 (B:246-389) mRNA capping enzyme alpha subunit {Yeast (Candida albicans) [TaxId: 5476]}
eentvdfqlefvfnevqyldydakpnliklrvwqgsnvhtdfakldlsdddwerlkaleq
plqgriaecrqsttkkgywemlrfrndksngnhisvvekilvsikdgvkekeviewcpki
srawkkrendrr

SCOP Domain Coordinates for d1p16b1:

Click to download the PDB-style file with coordinates for d1p16b1.
(The format of our PDB-style files is described here.)

Timeline for d1p16b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p16b2