Lineage for d1p16a2 (1p16 A:1-245)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734347Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 734591Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (4 families) (S)
    has a circularly permuted topology
  5. 734618Family d.142.2.3: mRNA capping enzyme [56100] (2 proteins)
  6. 734619Protein mRNA capping enzyme alpha subunit [90032] (1 species)
  7. 734620Species Yeast (Candida albicans) [TaxId:5476] [90033] (1 PDB entry)
  8. 734621Domain d1p16a2: 1p16 A:1-245 [87662]
    Other proteins in same PDB: d1p16a1, d1p16b1

Details for d1p16a2

PDB Entry: 1p16 (more details), 2.7 Å

PDB Description: Structure of an mRNA capping enzyme bound to the phosphorylated carboxyl-terminal domain of RNA polymerase II
PDB Compounds: (A:) mRNA capping enzyme alpha subunit

SCOP Domain Sequences for d1p16a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p16a2 d.142.2.3 (A:1-245) mRNA capping enzyme alpha subunit {Yeast (Candida albicans) [TaxId: 5476]}
mvqleereipvipgnkldeeetkelrlmvaellgrrntgfpgsqpvsferrhleetlmqk
dyfvcektdglrcllflindpdkgegvflvtrendyyfipnihfplsvnetrekptyhhg
tlldgelvlenrnvsepvlryvifdalaihgkciidrplpkrlgyitenvmkpfdnfkkh
npdivnspefpfkvgfktmltsyhaddvlskmdklfhasdgliytcaetpyvfgtdqtll
kwkpa

SCOP Domain Coordinates for d1p16a2:

Click to download the PDB-style file with coordinates for d1p16a2.
(The format of our PDB-style files is described here.)

Timeline for d1p16a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p16a1