![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.3: mRNA capping enzyme [56100] (2 proteins) automatically mapped to Pfam PF01331 |
![]() | Protein mRNA capping enzyme alpha subunit [90032] (1 species) |
![]() | Species Yeast (Candida albicans) [TaxId:5476] [90033] (1 PDB entry) |
![]() | Domain d1p16a2: 1p16 A:2-245 [87662] Other proteins in same PDB: d1p16a1, d1p16a3, d1p16b1, d1p16b3 complexed with the phosphorylated carboxyl-terminal peptide of RNA polymerase II, chains C and D complexed with g, gtp, po4 |
PDB Entry: 1p16 (more details), 2.7 Å
SCOPe Domain Sequences for d1p16a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p16a2 d.142.2.3 (A:2-245) mRNA capping enzyme alpha subunit {Yeast (Candida albicans) [TaxId: 5476]} vqleereipvipgnkldeeetkelrlmvaellgrrntgfpgsqpvsferrhleetlmqkd yfvcektdglrcllflindpdkgegvflvtrendyyfipnihfplsvnetrekptyhhgt lldgelvlenrnvsepvlryvifdalaihgkciidrplpkrlgyitenvmkpfdnfkkhn pdivnspefpfkvgfktmltsyhaddvlskmdklfhasdgliytcaetpyvfgtdqtllk wkpa
Timeline for d1p16a2: